SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI92176 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI92176
Domain Number - Region: 595-691
Classification Level Classification E-value
Superfamily Acid proteases 0.00464
Family Retroviral protease (retropepsin) 0.045
Further Details:      
 
Domain Number - Region: 321-359
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0178
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI92176
Sequence length 714
Comment (Physcomitrella patens)
Sequence
MQSNYGKIQGTLFSVKRSLKDKNGGESFDGESQFRIQALTSITDKLLEYWRISILPSTAR
RPTRSRAGKHENENKNFEGSLGGVSGGDSFKEQDMHMDPSIASMFQAFSLSMQQQQSNNR
KEALATKALQVVVNKIDQFDEMNISRYLRCYVCEMELNRVSEKKMVELFGLATIPEIRDH
ITSITDRYGNLWEVEKLTLEPNKVDLFLQAADGELQWKLELLLEDKEEDEGLTTKWKNVE
DAMGLLTKRERRKDRSNIPKTVQAPTAPVCTTPPTMPTVQPSTSLSKKADMEMEEIIRGM
QDLQIKLARLEENTSINNLKNVSKQGYVQRCIWCDDASHTRKDCNEFNNMIRQGVICWKD
GKIALKDRDGLLQTNFGKGGMRALVQDYLKDHETAARESTSYGARIDDDLGGSTKTSEFW
ASAVSTIQEGKLPREALLRTAATIRGTTGWEDPVESLSVHAYIAKSQHEALMEEKRRGNF
DDTRKGNSCKRQTRGDKLLSDIEAATNLKAVLEERILNAKVEFTLKEVLRIAKKEFHDVI
IDSIKRKRQLMGETRMSHAIDARIYRDEEEIDIGYKQPTNEKNGYHQRARATTEVLVKVG
DIEESIVALVDHGSEINLMSKDLYKKQKWPIDMEHGWVIRAANNTRGELYGACPDVKIRI
GDVATEQHFFVQDTTSYPLILGQPYITAIRMETKVFDDGSAYARICSEDGRKAI
Download sequence
Identical sequences A9TFR1
3218.JGI92176 jgi|Phypa1_1|92176|fgenesh1_pg.scaffold_221000023 XP_001777462.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]