SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI92651 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3218.JGI92651
Domain Number 1 Region: 18-65
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000733
Family Retrovirus zinc finger-like domains 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI92651
Sequence length 225
Comment (Physcomitrella patens)
Sequence
MEEMAVNMVKDKEKRQKPTNTRTNVWCSNCQGHGHLVTECPSPSQVLGKCTFCGGKHLTA
NCWNLQRQQQFSNLTMIPLTQWDVNQVQTRNTFKWHENRSNQQNRAVNHFQNSTYNQGFV
SSPQNYDQQIQSPEKMEGINRGAQDSPVNRVECVYTVLTRSQQKGKGPIKHLEDPKAKGK
SHPITDPSHSGPDTGKVLSPDLVAKPNEVPITESSVPSRAGLFPP
Download sequence
Identical sequences A9TGZ9
XP_001777873.1.60028 3218.JGI92651 jgi|Phypa1_1|92651|fgenesh1_pg.scaffold_228000033

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]