SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI92654 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI92654
Domain Number - Region: 262-301
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0107
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI92654
Sequence length 430
Comment (Physcomitrella patens)
Sequence
MYMDPSIASLFQAFSLSMQQQQSNDRKEALASKALQAVVNKIDQFGGRNISRYLRCYIRE
MELNRVSEKKMVALFGLATIPEIRDHITSIMDRCGNSWEDFSHALKDEYFLEDADRVTKK
LFLGWIERPNKNLQATELLREFERQYSQLSKVEKWTLEPNKVDLFLQVVDGELQEKLEPL
LEDKEEDEGLTTKKDRSNIPKTVQAPKAPVCTTPPTMPTVQSLTSLSKKADMGMEEIIRG
MRDLQIKLARLEENTSRNNSKNVSKQGYVQRCIWCDDASHTRKDCNEFNNMIRQGIICWK
DGKIALKDMEDLLQTNVGKGGMRALVQDYLKEHEIVVRESTSYGARVDDEIGGSTETSEF
WASAVSTMQEGKLSREALLRTAATIRARTGWEDPVESLSVHAYIAKSRHEALMEEKRRGN
FDDMREGNSS
Download sequence
Identical sequences A9TH02
3218.JGI92654 XP_001777876.1.60028 jgi|Phypa1_1|92654|fgenesh1_pg.scaffold_228000036

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]