SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI92690 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3218.JGI92690
Domain Number 1 Region: 645-706
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000905
Family PHD domain 0.0055
Further Details:      
 
Weak hits

Sequence:  3218.JGI92690
Domain Number - Region: 1100-1126
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000206
Family Retrovirus zinc finger-like domains 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI92690
Sequence length 2357
Comment (Physcomitrella patens)
Sequence
MQIFPPGEPWYCGLCDGYESRGEDTEATDKTPGDSMTSSQNTCGQWNSTASGGKKKLTNV
RGLQEVVQQEKASLVDIKPLQTAFQSGIDRFASGETGEASRKSKRGRPLKNASPALPSKR
RRADSGISKAKPDDGNASSSVLEQAGDAEEVAVESRREPVGATCSFSIDLPANAGTTPSE
VDEGVLPAVVPTESNDGQIQNVEGRAGLKEGQLDDTKLANSDKVLQSMAMKDTESSTEAA
LGPVTDMSTVQVVKSEEMDASHAVPEDMKLQDLEADARSGDLSGHLQTSAAEAEIVLLQP
SLTLVSNAHNVDNQSFGNASEQGVKVLASDQHVKVKCSVKENENASAIHALKEPLLSENP
QRNAFESIRKATLSEAQEKRSEPPLANPAGPSSSAASLTSSPSPLVMRTSSSPPLSNSHS
PVLDTSSTSTASPFEGLQSQSRDSITFTPLDSPQFLKPALEQSGGDGKVSLVSKPPFKAS
SSSPSTITSNLSRSEKIVTSDSSPHVQCMMQPIVHLSPSAALNPLVTDVDDVAELSNLVS
GLPVPSKRLRKGQQASPPVLEANGFVAQSARKRKGQSVDISQSGHILPFRDGKELNRTSS
MRDQWLVKTVLPKVPENGSSRTEPDDTLSGKSRESIPEDDRDGSPSNLLVEDVKVCDTCG
NTGYEELLALCSSCNEGAEHTYCMRVQMDALPEGDWFCETCQMKQRHGGPKSLERLIAPS
KSICRSDSLNSRPKPVSIQGNSRSRLSDRLNHKKPRLTSVRKSPSKAPIVQMPVKRLASD
SLISPVSRKLPSESFPWATSSTISPPPMPQAPTPSAKPSLTRETTLKSAPDTGKVKFLAP
SAVANFSSGARANAAKAVIVTSQPPKAVTSAQASSKSRFASLSSISESSTPSKATSLNSS
RVLLASSPTPILSKSASGKLSADFSTPSKALTAKPSGDYPFLLSSNSRQGNGMKSSGQPK
SGRDGGISDGNSLPPVGRESLSSMTTTPGSKLMRLGRNTSSGLSGEPRPSPDTPRPPLEH
GKGIQRSGQGTGGSYAAGTGLSQDASKAGGKDKASPRSELTAGVGSTIAGRGTSELASLS
GFPGKNVKPNTSIWSAPWLGDSSSTRCLACKGIGHNAQDCPKGNSFASEQKTMTGLSISP
GASPKPPKNSKEVGPTDLDAHASAPGVKGEQLEKVSSGPVFQGLQIGIESVPGNSSLEPE
KSKTLLPSPTPGDLVHRRSPSFKIHDSSSAASKVPSLLTSTSFQQLVTGQISSGVSSVAN
EDIPHRQGSKAESGCSNAKAQAGAYDTEGPPGVETAHVDSKTSAMQNSTSPAVKNEGILV
LNASQISGPKGPQGHSNQPPEAIASVPAPPVLPRGSASTVWGPRPHWMVGLSAHAVQSPQ
TGHVHLPGQVPTFAPSGPVIYGQSAPVTYLASQPSQLLLSYASSTLPPGLSPTPPITPAA
LDDAAIPSADISWRGAFEVKDGQTTVMFDEIRAHVSTRAVAKVHEVAAALPQRLRLEQVQ
RSLDLETWPRQFIQRPPTDGSIAMYFFADSGESIEKFHHNLVDKMVARDLVLRAQLEDAE
LLIFPSDKLAEQFQRSLDVLEMTNGDWQASGALGKDGWNNHMFLWGVFRAKKQAAKLVSL
PSFVAKEVPGTEALQSLPGSVSRAPAMCDTALKVKHSNSGVENTGEIDMEVDMEGGKECG
VSDKAVKRHDTTNPPLTPPLSPTGGNTRTPIALSKATDSTLQSLVLNTDVDKAKEDLDLP
PGFAPTLTLPPTAVALEEPSSGSTLPPGFGKTEARKQVEAGSTADAAEIVELGGPKLRHS
ASSVEVLKDSNTLSASPFPAPSPRENEVGQPSSRPSTTKRSRSISRSPSRAKEKERDKGR
DRPFERAKERERRDRDPKRGHDRSRERVWDDQRDRERDRDYERDKDRSQAWDRSKERDRA
RLKDKDRARERDRARERERDRERERDRERERERERERLLERSKDRKHRPRDSDQDLDSRT
SRYRRSRSRSRSRSMSRRKGISRSPAAGSRKARSRTPVRQRSRSPSPSRKYPNYRRQSVS
GSDSPDSLSMEILQDKMIAVSRSRKADRDVMQRKRRSASDKDVGEKSFRPSSRWKARPVD
DRRSGSAGASNSKTVGKSNTAPISRSVTPVLDMNEGVSEAFSAEGAAASTSLPDLNTDSV
ESGVAFHDFLPADEAGPSKNPEAVSPVAEQTFFPGARPATTLPNLTRMNFRHDSEPVSAR
ARWEFAVSSTRPEYSARSSAYQFLHTSRSDPNPDLELALGGREPSLERTVPLPLFVDGHA
ISPDLDFALHAKSPDLSVGLSTCPHVPGGPGIDSGAVTASLALSLAVPQYRKEGNSWVQV
EDRGVLIPEDVDIALTL
Download sequence
Identical sequences A9TH37
XP_001777945.1.60028 3218.JGI92690 jgi|Phypa1_1|92690|fgenesh1_pg.scaffold_229000019

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]