SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI92730 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3218.JGI92730
Domain Number 1 Region: 139-166
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000858
Family Retrovirus zinc finger-like domains 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI92730
Sequence length 388
Comment (Physcomitrella patens)
Sequence
MFVKEAQSATITSSLERAKVWEECHYDQNLIVGAMMIPSQGGYQMTNWNDASRSYLGRNE
YGTIPQGIVDVVPLQAVPPSSSHSYAPYSMYQKSISTKKLPNALVSRDPNESLLLTLTKK
MDELAVNLAKDKEKRHKPTNMRLNVWCSNCKGQGHLVTECPLPPQMTVQLLTRGQQKDKN
PIQDIDEPIAGEQVAPSMGLNEPISVLGRISILKLQQTEELNSVPRANLPGPSNPSPITS
SIPNMRPESVAQSNEVQIMEASVSSKQFRSLRSSDLYAVSRNVLSVERSCWGRKFQGSPS
CCSNFESRAEEYLTSRKDLVNIGQAQVSTLPIPKVLEERSHFQHQLELRDVQILKLEAQV
RELGEYNEDLSAELRQEPMEELEEDEDL
Download sequence
Identical sequences A9TH77
jgi|Phypa1_1|92730|fgenesh1_pg.scaffold_230000003 XP_001777991.1.60028 3218.JGI92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]