SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI92777 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI92777
Domain Number - Region: 352-397
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000213
Family Retrovirus zinc finger-like domains 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI92777
Sequence length 711
Comment (Physcomitrella patens)
Sequence
MVNKNESIASRKINQLRERQGRAQGRNLHREEQEHNLKRKHRQNWIKPWLQACWRIRTYQ
EPDRLLILQSYVPLEKLLRALAGNFVNIPVEILRPLTEREGGIEVFGTPLGNFPVGGTAE
TSNRGFVDWHELVANKGNYIVFQNLTFLPASQPIKLFAGNNNKARTVESSVIRVRKSRDY
FKTNFRGTENSMAAGGPAVPIAVQMGTLGDRTTSVAPLPTFCGLSASLERAKVWEECHYD
QHLTVGATMILLQGGYQMTNWNDASESYPGRSDYGTIPQGIVNAVPLQAVLPSSSQPYVP
YSAYQKPIPMKELTNELVSRDPNESLLLTLTKKMDELAVNLAKDKEKRHKPTNMRPNVWC
SNCKGQGHLVTECSSPPQMMVQCTFCGGKHTTANCWNLRKQQQVGQQTMSQPTSWDVNQM
QTSQPAEDKGPVQRDSPVHRVEVVNAVLTRGQQKGKNPIQDLDDPIEVTTVAPSKRRTER
ISVLGRIPILSPQQDEEPTSVSRANFSGTSRPIPNDHVLIPAQSNISSYPLKEPLVVEES
TKRKELLPNKFVSGEFTANHSISANTQRFIMSREKVKRASEKEEEGRRKFAGMQRGRRTL
EVRSFILFCERQTIYNQSKLEVEKMKQQLELNQTKMATLEQEKKTMSDQFRVKREEMQGE
INTLKEVAKKLEEELVSVRWPQGSIEGSIGELEQKVKQQQYQLEAKDTRIL
Download sequence
Identical sequences A9THC3
jgi|Phypa1_1|92777|fgenesh1_pg.scaffold_230000050 XP_001777985.1.60028 3218.JGI92777

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]