SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI92845 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3218.JGI92845
Domain Number 1 Region: 135-178
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000968
Family Retrovirus zinc finger-like domains 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI92845
Sequence length 323
Comment (Physcomitrella patens)
Sequence
MFVKESQPVTVAASLARAKVWEECHYDQLLMVGTTMIPSVGNQVPTTNTMIGSYPRMIAP
SMGNPNSQGVVNATPLQALPPVATYPSPMAYRQPEVSMNAIINDSNEALLLNLTKKMEEL
AVHMTKDKEKRHKPSNMRPNVWCNNCKGQGHFDTECPSPHQKMGQCMYCGGKHNTANCWY
LPRQQTMIQPTVWDINQVQTGNMGGWNGNRNNRMNRGFGNFQNPNYNQPYGTDMQNEETN
KPQESSVHRVEAIHAVLTRNQQKGKEPIQILEKSIPTPVNRPIPKSAPLLDEASPSQPNS
TNILVRPPILQVPILHQYGGQSH
Download sequence
Identical sequences A9THJ1
XP_001778070.1.60028 3218.JGI92845 jgi|Phypa1_1|92845|fgenesh1_pg.scaffold_232000014

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]