SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI92871 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI92871
Domain Number - Region: 243-263
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0068
Family Retrovirus zinc finger-like domains 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI92871
Sequence length 356
Comment (Physcomitrella patens)
Sequence
MIRAAAWVRPEVFHNPKLTIRKEHSLYYTRYSEENINEYNAKTAANGWYWLAAKNTINSP
NVPRDLLSSSRVNVFGSSLQMKRKISVVIVKVAEESSTPAKGCYGNKSGRCSSVGEHPTT
RAHLIDPEKTRAPFTDHHGIDCSSTGQTPAHPAPLSPRIGDNATQSTCNTDTLQFLGLSH
YLWHESCLKIIASRLGQVLFIEESSSYSHKTVGPHIKVLLHNINKTPKPTLDTPLLHKIL
ASGHPHLCTKCKGLGHTSIECKHRPLLQPPPYRGQRQQEHTKDNQETPSHAPRRHHSINH
ATTRGKDSQGTTLTELELFPPQRLPPQQELFPESPQQRLNKDFINQLENESRSHLV
Download sequence
Identical sequences A9THL9
jgi|Phypa1_1|92871|fgenesh1_pg.scaffold_232000040 XP_001778083.1.60028 3218.JGI92871

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]