SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI93149 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI93149
Domain Number - Region: 219-259
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00942
Family Retrovirus zinc finger-like domains 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI93149
Sequence length 641
Comment (Physcomitrella patens)
Sequence
MELNRVSEKKMVALFGLATIPEIRDHITSITDRYGNSWEVFSHALKDEYFFEDDDCVTKK
LFLEWIEWPNKNLQATELLREFERQNSQLSKVEKLTLEPNKVDLFLQAADGELQEKLEPL
LEDKEEDEGLTTKWKNVEDAVGLLTKKERRKDRSNIPKTVQAPKAPVRTTPPTMPTVQPS
TSLSKKADMGMEEIIRGMRDLQIKLVVLEENTSTNNSKNVSKQGYVQRCIWCDDTSHTRK
DCKEFNNMIRQGIICWKDGKIALKDREDLLQTNFGKGGMRALVQDYLKEHETAARESASY
GARVDDEIGGSTETTIRMEIKVLDDGSAYARVRSEDGRKAVQFLTVPPNHERNRDRLREK
PLPKIVERFKDFGELGTLQDDERILGVYEENGLEDSLELITSIGLGDNDKIIEIHSREIH
SVLESFQALEVTVETRYKTADKKVKPVAGPLPEDSKEQIGEASKEASLRDPMSIGYQFTK
ETFEEFKIGSDGSLLLEEITCFKKMLAKQGRSFAFESHEIGCVDPNIITPMVIFTVPYLE
YWKQLPTPVQILSGQVQSPRYSQPGHIEMLRSIPITRVNKKEKDQFTRRMSLAVLFSVPF
QGTLFSVKGSLKGKNEEKSFDDESQFWILALMARANFGSKL
Download sequence
Identical sequences A9TID4
3218.JGI93149 XP_001778380.1.60028 jgi|Phypa1_1|93149|fgenesh1_pg.scaffold_237000028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]