SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI93175 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI93175
Domain Number - Region: 436-473
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0215
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI93175
Sequence length 757
Comment (Physcomitrella patens)
Sequence
MKKKKKKKVYTIGLTNNEEVEDDDDDEEYQLLSEKRQGSKEKKVEEHQGESSSNDRRYPK
SKRKQRGEWWKDYNFPQVSEEHANVALLANPMNICDAMKSTNVLNYLEYWEHRPTPAQIL
SDQVQSPRNSQPGHTEMLRSILTTGVSRKRRTNSHDGFEEPIGSNFENPIRLRENLGHTT
GLSQSDAKTNLTQLREHPGYYGHLTHDGTRIGRATQCGSDYGVSILFRAILFFVTFQGTL
FTKMVAQFGLAMIPEIRDHITSITDRCGNSWEDFSHALKDEYFLEDAARVTKKLFQEWIE
RPNKNLQATELQKEFERQYSQLSKLYGELQEKLEPLLEDKEEDEGLTTKWKNIFCKQVGL
LTKKERRKDRSNILKTVQAPKAPIRTTPPTMPTVQPSTSLSKKADMGMEEIIRGMRDLQI
KLARLEENTSISNSKNVSKQGYVQRCIWCDDASHTRKDCNEFNNIIRLEIICWKDGKIAL
KDREDLLQTNFGKGGMRALVQDYLKEHETVVRESASYGARVDDEIGGSTETSEFWASAIS
TMQEGKLPREALLRTAPIIRGRTRVLEERILNAKVEFTLKEVLGIAKKDFHDVIIDSIKR
KRQLMSETGMSHAIDARICRDEEEVDIGYKQPTNEKNGYNQRVRFEDSSDKEMETLSHYT
RKHWARATIEVLVKVGDIEELIVALVDHGQPYITATRMETKVLYDGSAYARVRSEDGRKV
VQFLTIPPNHERNRDRLREKPLPKIVEGFKDYGEVPL
Download sequence
Identical sequences A9TIF7
3218.JGI93175 jgi|Phypa1_1|93175|fgenesh1_pg.scaffold_238000001 XP_001778415.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]