SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI93192 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3218.JGI93192
Domain Number 1 Region: 174-216
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000165
Family Retrovirus zinc finger-like domains 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI93192
Sequence length 355
Comment (Physcomitrella patens)
Sequence
MASGGVPSVPTGPSVPPIGPIGPAVPISVPMGQVGDRTTIALSLVRAKVWEECHYDRILN
SNPTLILTQGSSKFPNWSNLANSITGAMAPATHSIVPIQGVLNPVPLQAVPSPMASTYPQ
FALYQPLGVNTQELPMLPSSKETNETLLLNLTKKMEELAVNMAKKKEKRPKQTNFRANVW
CTNCKGQGHVVQDCPSRGNMKIQCMNCGGKHPTNNCWYLSNPHFNNTMSPPISWDVQIQS
SQEDINPVLQDSPVNHIEVVQAVQTRGQRNLQSILKKDKIIEEQPEPIQKKATIFAKPAN
QLRPVLVPTDSFNSTPIAPGGVNSQCPVQSIPIETVSMLSRILISTLIEPPNSVL
Download sequence
Identical sequences A9TIH4
jgi|Phypa1_1|93192|fgenesh1_pg.scaffold_238000018 XP_001778402.1.60028 3218.JGI93192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]