SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI93262 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI93262
Domain Number - Region: 308-402
Classification Level Classification E-value
Superfamily Acid proteases 0.000656
Family Retroviral protease (retropepsin) 0.04
Further Details:      
 
Domain Number - Region: 22-61
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0157
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI93262
Sequence length 565
Comment (Physcomitrella patens)
Sequence
MRDLQIKLARLEENTSINNSKNVSKQGYVQRCIWCDDASHTRKDCNEFNNMIRQGIICWK
DGKIALKNREDLLQINFGKGGMRALIQDYLKEHETVVRESASYGARVDDAIGGSTETSEF
WASAVSTMQEGKLPREALLRTAATIRGRTVHAYIAKSQHEALMEEKRRGNFDDTREGNSF
KRETRGDKAREAASQELPVKDTSSSLGEKTTETKDKGKSIAYKLLSDIEAATNLKGVLEE
RILNAKVEFTLKEVLGIAKKEFHDVIIDSIKRKRQLMSETGMSHAIDARICRDEEEVDIG
YKATTEVLVKVGDIDEPIVALVDHGSEINLMSKDLYKKQKWPIDMEHGWAIRAANNTRGE
LYGACPDVKIRIGDVATEQHFFVQDTTSYLLILGQPYITTIRMETKVLDDGSAYARVRSE
DRTKAVKFLTVPPNHERNRDRLREKPLPKIVEGFKDFGEEVLSRDEGAFDASFIGILENG
NIMYKKVDDFKRKERKRLYDIEGQLRKIGTLQDDERILGVYEENGLEDSLELITSIGLGD
NDKIVEIHSREIYTMLESFQAPESQ
Download sequence
Identical sequences A9TIN8
3218.JGI93262 jgi|Phypa1_1|93262|fgenesh1_pg.scaffold_239000040 XP_001778453.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]