SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI93298 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI93298
Domain Number - Region: 131-167
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.014
Family Retrovirus zinc finger-like domains 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI93298
Sequence length 284
Comment (Physcomitrella patens)
Sequence
MFIKESQPVTVAASLARAKMWEECHYDQLLMVGTTMIPSVGNQVPMTNTMIGSYPRMIAP
SMENPNSQGVVNATLLQAIPPVATYPSPMAYRQSEVPMNATINDSNEALLLNLMKKMEEL
AVHMTKDKEKRHKPSNMRPNVWYNNCKGQGHFDMECPSPHQKIGQCMYCGGKVNTANCWY
LPRQQTMIQPTVWDVNQVQTGNMGGWNGNRNNRVNRGFGNFQNPNYNQPYGTNMQNGITG
TSGGSNSRSIDKKSAKKQRTNSNIREIDTSPGQQTNTKICSIIG
Download sequence
Identical sequences A9TIS4
jgi|Phypa1_1|93298|fgenesh1_pg.scaffold_240000035 3218.JGI93298 XP_001778525.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]