SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI93585 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI93585
Domain Number - Region: 200-230
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0128
Family Retrovirus zinc finger-like domains 0.0061
Further Details:      
 
Domain Number - Region: 218-271
Classification Level Classification E-value
Superfamily Hepatitis B viral capsid (hbcag) 0.0589
Family Hepatitis B viral capsid (hbcag) 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI93585
Sequence length 312
Comment (Physcomitrella patens)
Sequence
MLKIRDYITSITDRYGNSWEVFSHALKDEYFLEDADRITKKLFLEWIERPNKNLQGTKLL
REFERQYSQLSKVEKLTLEPNKVDLFLQAADGELQRKLELLLEDKEEVEGLTTKWKNIED
TVGLLAKRERRKDRRNIPKTVQAAKTPIRTTPPTMPRVQPSTSLSKKADMGMEEIIQGMR
DLQIKLARLEENTSTNNLKNVSKQGYVQRCIWCDDTSHSRKDCNEFNNMIRQGIICWKDE
KIALKDREDLLQTNFGKGEMRALVQDYLKEHETTARESTSYGARVDDDLGGSTETTEFWT
SAISTMQEGKLP
Download sequence
Identical sequences A9TJJ5
3218.JGI93585 jgi|Phypa1_1|93585|fgenesh1_pg.scaffold_245000012 XP_001778801.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]