SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI93645 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI93645
Domain Number - Region: 139-170
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0122
Family Retrovirus zinc finger-like domains 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI93645
Sequence length 193
Comment (Physcomitrella patens)
Sequence
MFLKEAQSATIASSIERAKVWEECHYDQNLIVGATMIPSQGGYQMINWNDTSEDYLGKND
YGTIPQGIVDVVPLQAVPPSSSHLYAPYFAYQKPTPTKKLPNVLISRDPNESLLLTLTKK
MDELAVNLAKDKEKRHKPTNMRPNVWCSNCKGQGYLVTECLSPPQITVQCTFYGGKHITT
NRWNLRKQQQLSN
Download sequence
Identical sequences A9TJP5
jgi|Phypa1_1|93645|fgenesh1_pg.scaffold_245000072 3218.JGI93645 XP_001778830.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]