SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI93744 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI93744
Domain Number - Region: 258-294
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0288
Family Retrovirus zinc finger-like domains 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI93744
Sequence length 422
Comment (Physcomitrella patens)
Sequence
MEGGNLDSASSRIGRRASFGGQGMHFDPNFASMFEALTLFMQQQEQQVKDRKESMANKAL
QAIVDKNDQFEGKDITKYLRCYVKELELKRISESEMVQLFELAFAREIRNQVKFLIQHFG
GSWEKFSQALKDEFFLEDSDRVTKRSFFEWIEKPKKDLLAIELLRKFEKQYSSLSKKERQ
LLDPSKVELFLQETDGKLQEKLEFMLEDKEEDEGLTINWERIEDVVRTLIKRKRRKDMGG
DQRSLQASKKGQSSRISTKQRPRPMEDVVHRCMWCDSIDHSKRECEEFTEALRKGVVFFR
DGMIHSKENGEKLETNFDKRGMKLFTGDTFKVQTISSNEASTYWVEADPSRCLSINLEFP
EEFNSLWISAMRYAKKKNFTGDDLKRVGNNIRQITGWDDPVDRLSVHAHIARSQYEALIE
EK
Download sequence
Identical sequences A9TJZ0
3218.JGI93744 XP_001778933.1.60028 jgi|Phypa1_1|93744|fgenesh1_pg.scaffold_247000021

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]