SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI93965 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI93965
Domain Number - Region: 277-305
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0366
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 
Domain Number - Region: 33-96
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.0863
Family Insect pheromone/odorant-binding proteins 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI93965
Sequence length 334
Comment (Physcomitrella patens)
Sequence
MDPSIASLFQAFSLSMQQQQSNDRKEALATKALQAVVNKIDQFDGRNISRYLRCYVREME
LNRVSEKKMVALFGLATIPEIRDHITSITSRCGNSWEDFLHALKDEYFLEDADRITKKLF
LGWIERPNKNLQAIELLREFERQYSQLSKVEKLTLEPNKVDLFLQATDGELQEKLEPLLE
DKEEDEGLTTKWKNVEDAVRLLTKKERRKDRSNIPKTVQAPKAPIRTTPPTMTTIQPSTS
LSKKADMGMEEIIRGMRDLQIKLARLEENTSINNSKNVSKQGYVQRCIWCDDASHTRKDC
NEFNNMIRCQGQRLDEKKYTPKGYLDIISQNINK
Download sequence
Identical sequences A9TKJ7
3218.JGI93965 jgi|Phypa1_1|93965|fgenesh1_pg.scaffold_251000039 XP_001779115.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]