SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI94000 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3218.JGI94000
Domain Number 1 Region: 143-190
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000107
Family Retrovirus zinc finger-like domains 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI94000
Sequence length 281
Comment (Physcomitrella patens)
Sequence
MFVKEAQPVMISASLDRAKVWEECHYDQFLTACATMIPVQSNYQYPALNGSVGSYPQMIE
TVAQSSANTQGPVNVTPLQALPPQVTTAYAPYFPYQTHESTLAEKQIISASKDSNEALLL
NLTKKMEEMAVNMAKDKEKRQKPTNTRTNVWCSNCQGHGHLVTECPSPSQVLGKCTFCGG
KHLTANCWNLQRQQQFSNPTMIPPTPWDVNQVQTGNTFGWHGNRSNRQNRAVNHFQNSTY
SEGFVSNPRNYDPESRKNGGNKSRTSRLSSKSGGMCPYRSY
Download sequence
Identical sequences A9TKN0
XP_001779175.1.60028 jgi|Phypa1_1|94000|fgenesh1_pg.scaffold_252000022 3218.JGI94000

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]