SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI94042 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3218.JGI94042
Domain Number 1 Region: 232-276
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000022
Family Retrovirus zinc finger-like domains 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI94042
Sequence length 281
Comment (Physcomitrella patens)
Sequence
MESAANSPTYLSKPLTESNEGIEEKSIPLDIFLIGDTSNFNKIGSEDRHKSLANKDQFRV
YQNLSFLPHIQPIKLFGDNNSKLGRLGSLKKTFTGEIFYFNKEFSRTPASLMTSGGPTVS
IAVQMDTVDDRTTSIMPLPTFQGFPSVNRDQHLSQFLAGIVDIVPLQAVPPSSSHSYTPY
FMYQKSIPTKELSNALISKDPYESLLLTLTKKMHELAVNLTKDKEKRHKSTNMHPNDWCS
NCKGQGHLVTECPSPLQMTIQCTFCGSKHITTNCWNLRKQQ
Download sequence
Identical sequences A9TKR7
3218.JGI94042 jgi|Phypa1_1|94042|fgenesh1_pg.scaffold_253000007 XP_001779213.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]