SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI94106 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3218.JGI94106
Domain Number - Region: 134-177
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000249
Family Retrovirus zinc finger-like domains 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI94106
Sequence length 267
Comment (Physcomitrella patens)
Sequence
MAEEVPAVPIAVQMGAIGDRTTSVAPLPTFNGWPVISSVGNQVPMTNTMIGSYPRMIAPS
MRNSNSQGVVNATPLQAIPPVVTYPLPMAYRQPEVSMNATINDSNEVLLLNLMKKMEELA
VHMTKDKEKRHKPSNMRPNVWCNNCKGHGHFDTECPLPHQKMGQCMYCGGKHNTANCWYL
PRQQTMIQPIVWDVNQVQTGNTGGWNGNRNNRGPAHDINSANYRRNKQTTGISGTSSGSD
SRSIDKKSAKRQRINSNIGEIDTSPGQ
Download sequence
Identical sequences A9TKX9
3218.JGI94106 jgi|Phypa1_1|94106|fgenesh1_pg.scaffold_254000037 XP_001779267.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]