SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3218.JGI94200 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3218.JGI94200
Domain Number 1 Region: 709-855,889-966
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000000000761
Family Voltage-gated potassium channels 0.023
Further Details:      
 
Weak hits

Sequence:  3218.JGI94200
Domain Number - Region: 1020-1097
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0298
Family Voltage-gated potassium channels 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3218.JGI94200
Sequence length 1226
Comment (Physcomitrella patens)
Sequence
MDACQGSLVPLGNVLIFIAMIFSFYALVGVHFYGGKFKSRCIRKEDGTLPYMQEFCGTKG
KDCDGNTTIVSYMSTFCVKGLECKGNLTIANGSSGPHECNEIVTFEGWALQMYNMQDSAG
LNAEIYFIVMVIIGSYFAVNVCVAAISGVFIRVRHEHQVLLKKHKREQAFTFHNAIMLAN
VLKDVIRKDDAKLSWFGLVRRKTGSFNQNVTKFIRQGTKRISAMSNQGQSFLKRQISRGA
SFGARDSDSDFEDVDENELGGSFKKPKSFKTNKSMNRSMSRSLSRSLSSGAKSFTRSLSK
NTHKTAHHVHATLTAIMLCLRSFNILGSLSFFYMIVTIVFSIISMELYSGQFQVFPEGNP
LLLESTELTDNQKKAIQKREYLKYLRATHTHAKSIRTGDWLIGAIEGIQARVRRIYRNLS
VMVPVSKSVKHVSIPLLENKIASQMDTRSPKNEGYQYNQDDAINSQDFLDNQGSSSTSLS
EPQPSTPLHSILEMPEIKKKIYSEQSIAAKDNKLLQRKHSSFDPGLMMQSNASNITPIDQ
QSRDAILRRSSYNGIGGHSSRPRRLSKDATQMLVGAGFSNTTTHQDFREEKTALQSAMLA
LAHNLSMPSSLPLDDDIDANQHLYTTKEGEDDRHPSPKSKVDLYHSLSIQSFKGSSKRTS
FNIKDYEGYNMKYRQVPWYFSDKSLFIFKSDGPTRRFLVFVVENIWYKRFIMICAIIAVY
IVTQLNPAGFIDNVSIDLMDRFLLFTWTLDVVMKSIAYGVIFTPEAYLGDPYNIIDVVNM
FFQWVGFNPPSEAYSRVVHIMNTIRGTRFIPRIQGLRLLVSSMLHTIPAVASMFGFILVI
YFIFATIGIQIFRRRFAACTDPFVANRAQCVGTFINEVGLRSHRVWMNPPLHFDNFGSAM
LALFVCSTTDGWIQYFLHNSEDIPNTLYDNPVQGNKSINSIFFILFIIISNWLVIRLLIG
VFIDQFGIISGSKLLTERQKLWRDMNRIVQSLSPIKLPRIPINSVRRACYKLVHDSNAYR
YCMILIILTNYCWFASQHYDVHQTKTVQSVEMGFVAFYLAEVVVKLFGNHFHDWYHDTWN
VGELILVLGSSVCLYPDEGSVMAEWGIMYRFIQYEVYNFHVYGKGIPFRNFLETLVLYKI
GSQGLILSLRIEREKQLKQIFRNGAAIVIQSHIRRFLVQRGFIVSHPMKIAPIIKEEAYD
DYAEDSIERLKKKIMARLKVVLITGY
Download sequence
Identical sequences A9TL69
XP_001779361.1.60028 3218.JGI94200 jgi|Phypa1_1|94200|fgenesh1_pg.scaffold_256000041

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]