SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 321967.LSEI_0436 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  321967.LSEI_0436
Domain Number 1 Region: 111-353
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 9.17e-62
Family D-glucarate dehydratase-like 0.0000148
Further Details:      
 
Domain Number 2 Region: 1-124
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 8.52e-31
Family Enolase N-terminal domain-like 0.0007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 321967.LSEI_0436
Sequence length 355
Comment (Lactobacillus casei ATCC 334)
Sequence
MEITAITAFPRQVKLKTPFKLALGELRDITTLIIKIETDDGVTGYGEASPYAPVNGETNE
TEQAALPVFVNALTGCDPRNLEQVHARMDVVMAGHTALKCGIDTACSDILGKAASLPLWQ
LLGGHSHIVTTDITIPIGTPTQMVASARTYVAAGFTALKLKAGDNEAADIAAINAVCAAV
GPTISVKVDANQAWTVSQTLRIAAQLRAPNLIAIEQPVPDWQLLSLPLLRAQSHVALMLD
ESIHNAHDAADAIRLNAADLINIKLAKSGGLFGAAAIDATAAAAGVPCMVGCNAETRLGT
AASAHFIAAHENVHYGDIDSFMLLAETDWLSGGFTSDGPTLTLSDRPGLGVDVRL
Download sequence
Identical sequences A0A0R1EZR8 Q03BY1
gi|116493999|ref|YP_805733.1| 321967.LSEI_0436 WP_011674115.1.31893 WP_011674115.1.49750 YP_805733.1.65993

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]