SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 322710.Avin_24970 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  322710.Avin_24970
Domain Number 1 Region: 438-543
Classification Level Classification E-value
Superfamily SpoIIaa-like 3.34e-21
Family Anti-sigma factor antagonist SpoIIaa 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 322710.Avin_24970
Sequence length 553
Comment (Azotobacter vinelandii DJ)
Sequence
MMIAIREAWQAGLLRREHWLRNLVAGVIVGVVALPLAMAFGIASGVKPEQGIYTAIVGGL
LVSLFGGSRLQIAGPTGAFIVILAGVTAEHGVDGLQIATLMAGGILLLLGVGRLGTVIKY
IPDPVIVGFTAGIGVIIWVSQWKDFFGLPAVAGTHFHEKFWHLLQSLPQLHLPTTLLALA
SLALVIFAPRLRMLRRVPGPLIAMVAATVIQSFFRFDGVATIGSAFGGIPQGLPQLGLPE
ITPSRLIELIGPAFAIAMLGAIESLLSAVVADGMGGTKHDSNQELIGQGIANLATPLFGG
FAATGAIARTATNIRNGGNSPLAGIVHALVLVLILLFLAPLAANIPLAALAAILFVVAWN
MSELKHFKRMLRRAPRADVGILLITFGLTVFSDLVIAVNIGVILAMLQFMRRMASSVAVR
QQLERDLEPELLGNGHSRLPDGVLVYTVEGPLFFGAAETFERALASTHTDPRLLIIRLKR
VPFMDITGLQTLEEVIRQLERRRIRVKLCEASPRVHGKLERAGILELIGARDYHASFAEA
LSASEEKAEVTAS
Download sequence
Identical sequences C1DIK0 M9YJE3
gi|482895004|ref|YP_007893466.1| gi|226944583|ref|YP_002799656.1| 322710.Avin_24970 WP_012701074.1.101714 WP_012701074.1.69821 WP_012701074.1.78925 WP_012701074.1.92556 gi|482900722|ref|YP_007898515.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]