SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 322710.Avin_27220 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  322710.Avin_27220
Domain Number 1 Region: 146-425
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.7e-125
Family Enolase 0.0000000061
Further Details:      
 
Domain Number 2 Region: 8-143
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 4.42e-50
Family Enolase N-terminal domain-like 0.00000436
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 322710.Avin_27220
Sequence length 437
Comment (Azotobacter vinelandii DJ)
Sequence
MSNPSTSIQHVAAREILDSRGNPTVEAVVTLAGGATGVASVPSGASTGSREALELRDGAL
RYKGKGVMKAVDNVNGAIRERVVGLDALDQRAVDQAMLELDGTDNKAILGANAILAVSLA
TARAAAAARGLPLYAHLAELYGSPGEYSLPVPMMNILNGGEHADNNVDLQEFMIQPVGAA
SFKEALRIGAEVFHTLKQVLAERGLSTAVGDEGGFAPSLSSNEEALVVIQAAVERAGYVL
GQDITLALDCAASEFYHDGEYRLAGEGKTFDSRGFADYLAGLCERYPIVSIEDGLDESDW
VGWAYLTEKLGQKVQLVGDDLFVTNPKILREGIERGIGNSILIKFNQIGSLSETLEAIRL
AQQAGYTAVISHRSGETEDTTIADLAVATRAGQIKTGSLCRSDRVGKYNQLLRIEEALQG
KAPYDATALLKRRCCSR
Download sequence
Identical sequences C1DJX7 M9YF69
gi|482893480|ref|YP_007893681.1| WP_012701286.1.101714 WP_012701286.1.78925 WP_012701286.1.92556 gi|482897881|ref|YP_007898730.1| 322710.Avin_27220 gi|226944798|ref|YP_002799871.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]