SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 322710.Avin_49970 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  322710.Avin_49970
Domain Number 1 Region: 146-424
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.56e-125
Family Enolase 0.00000000623
Further Details:      
 
Domain Number 2 Region: 8-143
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 4.64e-50
Family Enolase N-terminal domain-like 0.00000436
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 322710.Avin_49970
Sequence length 439
Comment (Azotobacter vinelandii DJ)
Sequence
MSKPSTSIQHVAAREILDSRGNPTVEAVVTLAGGATGVASVPSGASTGSREALELRDGAL
RYKGKGVMKAVDNVNGAIRERVVGLDALDQRAVDQAMLELDGTDNKAILGANAILAVSLA
TARAAAAARGLPLYAHLAELYGSPGEYSLPVPMMNILNGGEHADNNVDLQEFMIQPVGAA
SFKEALRIGAEVFHTLKQVLAERGLSTAVGDEGGFAPSLSSNEEALVVIQAAVERAGYVL
GQDITLALDCAASEFYHDGQYRLAGEGKTFDSRGFADYLAGLCERYPIVSIEDGLDESDW
AGWAYLTEKLGQKVQLVGDDLFVTNPKILREGIEQGIGNSILIKFNQIGSLSETLEAIRL
AQQAGYTAVISHRSGETEDTTIADLAVATRAGQIKTGSLCRSDRVGKYNQLLRIEEALKG
KAPYDASALLKRRCCGGKA
Download sequence
Identical sequences C1DHV4 M9Y7C9
322710.Avin_45760 322710.Avin_49970 gi|226946589|ref|YP_002801662.1| gi|226946990|ref|YP_002802063.1| WP_012703053.1.101714 WP_012703053.1.78925 WP_012703053.1.92556 gi|482897884|ref|YP_007900519.1| gi|482897885|ref|YP_007900920.1| gi|482893483|ref|YP_007895470.1| gi|482893484|ref|YP_007895872.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]