SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 323097.Nham_0348 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  323097.Nham_0348
Domain Number 1 Region: 33-216
Classification Level Classification E-value
Superfamily ClpP/crotonase 4.57e-27
Family Clp protease, ClpP subunit 0.059
Further Details:      
 
Domain Number 2 Region: 393-453
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000000222
Family NfeD domain-like 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 323097.Nham_0348
Sequence length 465
Comment (Nitrobacter hamburgensis X14)
Sequence
MQAVQATLAVALAAAALVFSPLPASTEENGKLVLTIAIDGAIGPATTGYVKDALAKARER
HAEAVILRLNTPGGLASSMREIIADVLASPVPVIGYVAPSGAHAASAGTYILYATHIAAM
APGTNLGAATPVQIGSPVPGLPGIPDKGDKDKKNGSQQPEPTDAMTAKVTNDAVAFIRSL
AELRGRNADWAEKAVREAASLSASAALQAGVVELIARSPAELLRKVDGRTVDLVNGDRRH
LATKDATIETIDPGWVSQFLSIITDPNVALILLLVGTYGLLFEFMSPGAVAPGVVGTICL
LLGLYALNLLPISYAGLGLMMLGIALLTIEAFNPTVVLGLGGVIAFVLGALMLFRNEASG
YRLSWTFVGIVASMFTGLVLIVLGSLRRARKGPAQVGAQAMRGLPAEVLDWNDIEGHVFT
QGERWQARSTEAFKPGDTVEVASITDLTLTVRRRPALRGGEGGVR
Download sequence
Identical sequences Q1QRA3
gi|92115975|ref|YP_575704.1| WP_011508948.1.12189 323097.Nham_0348

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]