SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 323097.Nham_1743 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  323097.Nham_1743
Domain Number 1 Region: 139-422
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.09e-123
Family Enolase 0.000000022
Further Details:      
 
Domain Number 2 Region: 4-137
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 3.03e-55
Family Enolase N-terminal domain-like 0.00000448
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 323097.Nham_1743
Sequence length 427
Comment (Nitrobacter hamburgensis X14)
Sequence
MTAIVDIIGREILDSRGNPTVEVDVALEDGAMGRAAVPSGASTGAHEAVELRDDDQTRYF
GKGVRKAVDAINGEIFDAIGGMDAEQQAQIDEILIGLDGTANKSRLGANAILGVSLALAR
AAADSLDMPLYRYVGGVSARTLPVPMMNIVNGGVHADNPIDFQEFMIMPVGAKTFSEGLR
CGSEIFHTLRAELKKAGHNTNVGDEGGFAPNLPSASAALDFIMGAIVKAGYKPGDDVALA
LDPAASEFFKDGKYVYAGEGKTRSIEEQARYLAKLASDYPIVSIEDGMAEDDFEGWKLLT
DLIGKSCQLVGDDLFVTNVTRLADGIGKGLANSILIKVNQIGTLTETLAAVEMAYKAGYT
AVMSHRSGETEDSTIADLAVATNCGQIKTGSLSRSDRAAKYNQLLRIEQQLGAQARYGGR
AALKALA
Download sequence
Identical sequences Q1QMI9
WP_011510240.1.12189 323097.Nham_1743 gi|92117289|ref|YP_577018.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]