SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 323097.Nham_4611 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  323097.Nham_4611
Domain Number 1 Region: 398-483
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000275
Family Anti-sigma factor antagonist SpoIIaa 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 323097.Nham_4611
Sequence length 493
Comment (Nitrobacter hamburgensis X14)
Sequence
MRFFQAFRREWLTNIPTELLSGTLVALALIPEAIGFSIVAGVDPKVGLYASFSIACVTAI
VGGRPAMISAATASTAVLMITLVRDHGLQYLFAATVLMGLIQILAGALRLGLLMKFVSRS
VMTGFVNALAILIFLAQLPQLTHVGWQTYAMVAVGLSIIYLFPFVTKRVPSALVSIVALT
AFTIYSGIKLRTVGDMGELPSSLPFFAIPQVPFTLETLKIILPYSLTMAAVGLLESLLTA
SIVDDMTDAGSNKNRECVGQGVANFVTGFLGAMGGCAMIGQSVINVTAGARTRLSTFFAG
AFLLFLIVVLGDWVKQIPMAALVAVMIMVSISTFNWSSVTSLRSHPLSSSVVMLATVVVV
VATGDLSMGVLTGVILSGVFFAAKVARLLGIVTEPSEDGSQINYYVTGQVFFASAGSLID
AFDYLDVPARVRIDVSEAHFWDITAIGALDDIVLKLRRHGAQVEIIGLNKASATMVERFG
RHHRLSVGQKAVH
Download sequence
Identical sequences Q1QF23
gi|92109720|ref|YP_572006.1| WP_011505254.1.12189 323097.Nham_4611 gi|92109720|ref|YP_572006.1|NC_007961

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]