SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 323098.Nwi_0235 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  323098.Nwi_0235
Domain Number - Region: 39-106
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0345
Family Arfaptin, Rac-binding fragment 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 323098.Nwi_0235
Sequence length 161
Comment (Nitrobacter winogradskyi Nb-255)
Sequence
MLAEPETWVAIAFLLLMGVFAYVGVHRTVLSALDRRSARIKNELDDARRLKDEAAKLLAD
YKARHASAEREAQDIIASARAEAERIAAEAKAKMEDFVARRTKSAEGKIASAEAQAIADV
RAAAADAAVAAASSILSNSVKGQLADELLVQGVSEVRSKLN
Download sequence
Identical sequences Q3SW38
gi|75674434|ref|YP_316855.1| WP_011313570.1.37845 323098.Nwi_0235

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]