SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 323098.Nwi_0930 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  323098.Nwi_0930
Domain Number - Region: 95-145
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00615
Family NfeD domain-like 0.0081
Further Details:      
 
Domain Number - Region: 29-75
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0769
Family Bacteriorhodopsin-like 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 323098.Nwi_0930
Sequence length 148
Comment (Nitrobacter winogradskyi Nb-255)
Sequence
MIDLLASLGNWNWLILGLVLVGLELLTPGVFLFWLGLAAFLVGALSFVVDPTWQTQLLMF
AVFAAAAVPLWRRMARRESSGAASPFLNRRAEALVGRVFTLERPIVDGTGTVRIDDTIWR
VAGPDAPAGSRVKVVKADGASLTVATEP
Download sequence
Identical sequences Q3SU49
323098.Nwi_0930 WP_011314233.1.37845 gi|75675123|ref|YP_317544.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]