SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 323098.Nwi_1036 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  323098.Nwi_1036
Domain Number 1 Region: 39-153
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.7e-22
Family cAMP-binding domain 0.0092
Further Details:      
 
Domain Number 2 Region: 156-227
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000000000739
Family CAP C-terminal domain-like 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 323098.Nwi_1036
Sequence length 231
Comment (Nitrobacter winogradskyi Nb-255)
Sequence
MHTQTISAPAARILDIPHATAAEPVDPFSAIARCSGVIATEFSYKKDEEIYGEGEPSEYL
YQISRGAVRTYKLLSDGRRQIGAFHLPGDILGLDPGPEHRLTAEAIVDTAVRLVPRRSIE
KAATSNVHVARLLWTMTAIELRHAEDHMLLLGRKTAMERVATFLLEMDRRLAKAGMMALP
MCRRDIGDYLGLTLETVSRALSYLNDQGILMFSSARQIALRNRARLSAMEA
Download sequence
Identical sequences Q3STU3
WP_011314332.1.37845 gi|75675229|ref|YP_317650.1| 323098.Nwi_1036

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]