SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 323259.Mhun_0094 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  323259.Mhun_0094
Domain Number 1 Region: 1-174
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 2.35e-35
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 323259.Mhun_0094
Sequence length 179
Comment (Methanospirillum hungatei JF-1)
Sequence
MRHEIRFSGFGGQGIILSAVILGRAAALYDQKYAVQTQVYGPEARGGASMSAVIIDDEPI
LFPKVRDPDTYVIMSQQGFEKYGKNPRADAVMLLDSDLVHDRPSCTWVGIPATLSAKKDL
GREIVANIIMLGALTTATTVVSGPALEKAILDSVPKGTEDLNLKAMRRGQELGIEGGSS
Download sequence
Identical sequences Q2FPT9
323259.Mhun_0094 gi|88601413|ref|YP_501591.1| WP_011447168.1.85653

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]