SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 323259.Mhun_0127 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  323259.Mhun_0127
Domain Number 1 Region: 4-110
Classification Level Classification E-value
Superfamily Chaperone J-domain 4.58e-35
Family Chaperone J-domain 0.00012
Further Details:      
 
Domain Number 2 Region: 264-349
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 1.31e-20
Family HSP40/DnaJ peptide-binding domain 0.0032
Further Details:      
 
Domain Number 3 Region: 116-155,219-272
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 2.62e-19
Family HSP40/DnaJ peptide-binding domain 0.0072
Further Details:      
 
Domain Number 4 Region: 148-214
Classification Level Classification E-value
Superfamily DnaJ/Hsp40 cysteine-rich domain 2.88e-16
Family DnaJ/Hsp40 cysteine-rich domain 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 323259.Mhun_0127
Sequence length 378
Comment (Methanospirillum hungatei JF-1)
Sequence
MAAGDYYDILGVSRNADDTEIKKAYRGLARKYHPDVNKDPGAEDKFKEINEAYSVLSDAQ
KRQQYDRMGHEAFTNASKGSYGGGGYGGGFNADFSGFGDIFDFAGDIFGGFGRQRGPRRG
DDLLMRIEVSLRDAVFGADREIEVMHAESCTTCDGTGSETKKTKNCPKCGGTGQIRQATQ
TPFGNFVRQSTCDFCHGKGKVAEKPCSKCKGSGHEKVRRKVSVHIPPGVDTGMRLRLEGY
GEAGDHGAPNGDLYIEIHVKPEPRFHRDGDTLLTKIQITPAQAVLGTTVEVTTIDRRHLE
VKVPAGTQGGKKLRISGEGVRKRGRPGDLLVEVEVTIPKHVSGELKELYEKILELEGKKN
PGGSGNEKKGFFESILGG
Download sequence
Identical sequences Q2FQP6
WP_011447200.1.85653 323259.Mhun_0127 gi|88601445|ref|YP_501623.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]