SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 323259.Mhun_1615 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  323259.Mhun_1615
Domain Number 1 Region: 90-149
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000017
Family NfeD domain-like 0.007
Further Details:      
 
Weak hits

Sequence:  323259.Mhun_1615
Domain Number - Region: 11-99
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 0.0157
Family Multidrug efflux transporter AcrB transmembrane domain 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 323259.Mhun_1615
Sequence length 151
Comment (Methanospirillum hungatei JF-1)
Sequence
MVFEDFSYGWIIVLFGALFFVLEVFSPGFFLLVPGTVLLIIGVLVILGVDIFSSTYGIVL
GIGIALLAAIVTVYLYSRLTPGDEKPLTISMDSLVGRTGRVLNPADEETLSGKVSVEGQI
FSAKSKSGIIPEGAKVKVIASQGVHIVVEEE
Download sequence
Identical sequences Q2FRG4
gi|88602887|ref|YP_503065.1| WP_011448611.1.85653 323259.Mhun_1615

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]