SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 323259.Mhun_2359 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  323259.Mhun_2359
Domain Number 1 Region: 1-188
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 6.41e-38
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 323259.Mhun_2359
Sequence length 191
Comment (Methanospirillum hungatei JF-1)
Sequence
MSFDVMIVGIGGQGTILTSNILGKACVIEGIPVRGAETHGMAQRGGSVESQIRIGQEFGP
LIAPGSADMLLSFDLMEAVRAAHWLKPEGTIYTSREFVIPTSVFMQDFPAPTEQMLREML
GDRPAKIIDSRALAEEAGNILTQNIVMLGAASPMLPLKKESLQEAIRRTVPPKTIDLNLK
AFEMGIDAGKN
Download sequence
Identical sequences Q2FSK5
2005168214 323259.Mhun_2359 2005312396 WP_011449321.1.85653 gi|88603604|ref|YP_503782.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]