SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 323259.Mhun_2502 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  323259.Mhun_2502
Domain Number 1 Region: 10-112
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000000145
Family ScpB/YpuH-like 0.077
Further Details:      
 
Weak hits

Sequence:  323259.Mhun_2502
Domain Number - Region: 104-129
Classification Level Classification E-value
Superfamily NfeD domain-like 0.034
Family NfeD domain-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 323259.Mhun_2502
Sequence length 267
Comment (Methanospirillum hungatei JF-1)
Sequence
MNENDPGYTILKNKRDVTRFQILVDIAAHQPAIRQQEIAAGLGVTPQAISEYVRELTEEG
MLKAPGRGRYEVTREGVEWILHHAEVLETYARHIRNDVIKQVSVWTAIAAEDLKRGDPVG
VYMKNGLLYASKQPQSANGLSVSDTPKGEDAGVSGLEGIITHREATVLVCKVPRVERGGS
RKVRLDLLRDVISRVTVVACVGLEAWVSLKKIDRVPDLYFGSREGSVEAALHGIPCAIVI
VDEFFTDFLKQLEQADLSYEIHDLVSS
Download sequence
Identical sequences A0A1V5SRK2 Q2FSN6
gi|88603743|ref|YP_503921.1| WP_011449460.1.85653 323259.Mhun_2502

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]