SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 323261.Noc_1634 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  323261.Noc_1634
Domain Number 1 Region: 14-214
Classification Level Classification E-value
Superfamily ClpP/crotonase 1.59e-25
Family Crotonase-like 0.09
Further Details:      
 
Domain Number 2 Region: 386-451
Classification Level Classification E-value
Superfamily NfeD domain-like 7.98e-17
Family NfeD domain-like 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 323261.Noc_1634
Sequence length 459
Comment (Nitrosococcus oceani ATCC 19707)
Sequence
MFTSKRYFWILGPLVCLFLGGAVPAQQNQNLTGAAFLLDVRGVIGPATSDYVQRAMARGS
AEGAALIILRMDTPGGLDTAMREIIQDILASPVPVVGYIAPSGARAASAGTYIMYASHIA
AMAPATNLGAATPVHLPMGGRLPEKTPPPGEGEEAGTSSEDTLTRKAINDAVAYIKGLAA
QRGRNERWAEKAVREAASLSAQEALEMEVIDLIARDVSALLKRLDGRTVDVVGGEMTLQT
TGMTVIPVEPNWRDRLLAIIANPNVAYILMLVGIYGLIFEMANPGFVLPGVVGTISLLLA
LYAFQVLPISSAGLALMLLGIAFMAAEIFVPSFGALGIGGVIAFVIGSVILLDTNVPGYD
ISWPLIVAAAVSSAGFLYMVLFLTARSQRRPVVSGREQMLGATGKVTAVSEDKITVRVHG
ELWSAQVREPVILGQRVRVMELEGLVLIVKPELEENLHD
Download sequence
Identical sequences A0A0E2Z2J3 Q3JAP0
323261.Noc_1634 gi|77165111|ref|YP_343636.1| WP_002811415.1.20919 WP_002811415.1.77844 WP_002811415.1.91979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]