SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 323261.Noc_2223 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  323261.Noc_2223
Domain Number 1 Region: 150-212
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000000000275
Family NfeD domain-like 0.0073
Further Details:      
 
Weak hits

Sequence:  323261.Noc_2223
Domain Number - Region: 38-135
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 0.0366
Family Multidrug efflux transporter AcrB transmembrane domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 323261.Noc_2223
Sequence length 214
Comment (Nitrosococcus oceani ATCC 19707)
Sequence
MVRHVRVIWNTAFIGAICGSLLWLRREDIPAHLDALVLGILVGTLYGGLYWRYLFHRITR
KERRFERNRILVHYLSLFELLLTAATWSLYLLIALTLLILAAVLLDIFSGYWWSILISSF
GMAAALSLGGSIVRYERLYGALYYQYDSRSWLGGEGLLYQEGRAIQPLTPKGKIIINGEL
WHAVSLNGDNIEAGKKVEVISREGLTLYVDSLPQ
Download sequence
Identical sequences A0A0E2Z0X4 Q3J913
323261.Noc_2223 WP_002810338.1.20919 WP_002810338.1.77844 WP_002810338.1.91979 gi|77165688|ref|YP_344213.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]