SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 323261.Noc_2976 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  323261.Noc_2976
Domain Number 1 Region: 1-108
Classification Level Classification E-value
Superfamily SpoIIaa-like 2.75e-26
Family Anti-sigma factor antagonist SpoIIaa 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 323261.Noc_2976
Sequence length 111
Comment (Nitrosococcus oceani ATCC 19707)
Sequence
MNLHTEKTNGAVVLYIKEKRLDAHNSGELKDRMLELGEGGKVYLIVDLEEVRFIDSSGLG
ALLSGHKNTTLRNGSFKLCGLQSQVQSMFELTRLHRVFDIYPSVQEALGNN
Download sequence
Identical sequences A0A0E2Z3R7 Q3J6X8
gi|77166423|ref|YP_344948.1| 323261.Noc_2976 WP_002814245.1.20919 WP_002814245.1.60716 WP_002814245.1.77844 WP_002814245.1.91979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]