SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 323850.Shew_0810 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  323850.Shew_0810
Domain Number 1 Region: 51-140
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 2.49e-16
Family Pentapeptide repeats 0.0016
Further Details:      
 
Domain Number 2 Region: 230-326
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000000000000034
Family Voltage-gated potassium channels 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 323850.Shew_0810
Sequence length 326
Comment (Shewanella loihica PV-4)
Sequence
MKQTNQCCYHEDEGFSCTEPAEASGLCYWHDPKIIKDKPEDIARLEAFARNGGMLRGISL
KRANLPGIDLVRHHQKTGFDMSHAELYRANLQGAHMFNLNLQHASLMKADLREANVHCAN
LVGTNLLGIKWNGAKIENINTGKLLRQERLANEAERVGENEIALDYFEQAEEIYRDLRKA
AEREGLFAMGGDYLRKELTMRRHQMPKYSYSRILSKMIDIFCGYGEAPTRVIGFSMGLIF
VCALLYLFTGLNYDGNIHVFNWQNDLTTNLALFFNCIYYSVVTFTTLGYGDFTPIGYSRA
IAAVEAFTGSFTIALFVVVFVKKMTR
Download sequence
Identical sequences A3QB34
323850.Shew_0810 WP_011864616.1.33760 gi|127511744|ref|YP_001092941.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]