SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 323850.Shew_1786 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  323850.Shew_1786
Domain Number 1 Region: 49-155,195-253
Classification Level Classification E-value
Superfamily ClpP/crotonase 3.17e-20
Family Clp protease, ClpP subunit 0.038
Further Details:      
 
Domain Number 2 Region: 426-490
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000000000209
Family NfeD domain-like 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 323850.Shew_1786
Sequence length 500
Comment (Shewanella loihica PV-4)
Sequence
MHCLNRRSLSVIPLLLLLLLIALSLDKSVSAAEENSESAQQTTPQPIPLLQFSGAIGPAI
GEYLSEEIDHANRLPAELRPELIMIVLDTPGGLVTSLRSINQAILASKIPIACLVAPPGA
RAMSAGTYMLYACHIAAMAPATTLGAATPVQLGMPSSPQDSGSGSGSGSDPKESGSQDKA
AQKDGAGQSTPESTPKDNKDAMAHKVLNDAVAYIRSLANLRGRNVEFAERAVIDAATLTS
DEALAQNVIDLIAADPQELVAKLEGFSVVVDGKAKRLSLAGANLAPRQQSWRNRVIATIT
DPNIAYILMLIGIYGLLLEFYSPGIGVAGVTGGIALLVALYAFQLLPVNYAGLGLILLGI
ALIVAESMVPSFGILGLGGIAAFALGSLFLIDAEGGDLSISLPLIAAVTVTASGFSLWVL
SSLWKARKAANVSGDDLLIGASARVVKGFEKYGLVTLGGECWQARSDSQTQTGETVIVLG
RDKLTLIVTPAATLPDSDNP
Download sequence
Identical sequences A3QDV4
gi|127512714|ref|YP_001093911.1| WP_011865584.1.33760 323850.Shew_1786

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]