SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 324057.Pjdr2_2339 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  324057.Pjdr2_2339
Domain Number 1 Region: 4-111
Classification Level Classification E-value
Superfamily SpoIIaa-like 4.32e-30
Family Anti-sigma factor antagonist SpoIIaa 0.0000523
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 324057.Pjdr2_2339
Sequence length 117
Comment (Paenibacillus JDR 2)
Sequence
MSLQAELEHYRNVLIVRLRGELDHHTADIVRNKMEAEIMRGESHHIILSLKDLQFMDSSG
LGVILGRYKQIRSKGGKMVVCDVNPSVYRLFEMSGLFKIMSIYDNERMAISSLEVVS
Download sequence
Identical sequences C6CU54
324057.Pjdr2_2339 WP_015843938.1.29859 gi|251796349|ref|YP_003011080.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]