SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 324057.Pjdr2_3304 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  324057.Pjdr2_3304
Domain Number - Region: 15-54
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0628
Family NfeD domain-like 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 324057.Pjdr2_3304
Sequence length 71
Comment (Paenibacillus JDR 2)
Sequence
MTDQNHRSKSCRMERIGLVVDITDDRVRLEVEGKPVTVPRIKTAEYLELGDRVSWNGKIW
VKIREEEVKKR
Download sequence
Identical sequences C6D250
gi|251797295|ref|YP_003012026.1| 324057.Pjdr2_3304 WP_015844883.1.29859

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]