SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 324057.Pjdr2_4913 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  324057.Pjdr2_4913
Domain Number 1 Region: 80-139
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000000000144
Family NfeD domain-like 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 324057.Pjdr2_4913
Sequence length 141
Comment (Paenibacillus JDR 2)
Sequence
MLWIGWLILFAIFLLIELNTGTFYFLLLSISSLIALGMVFVNTSFLVQCFVFVGSAFLMY
VWLIPIIRKVIPTSTDKMPEIKERLIGQEAFVVQDIVRGEIGLVSVNGEIWSAVADESIS
KGEKVRIKGLGVTKLIVERSR
Download sequence
Identical sequences C6D001
gi|251798879|ref|YP_003013610.1| 324057.Pjdr2_4913 WP_015846462.1.29859

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]