SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 324057.Pjdr2_5613 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  324057.Pjdr2_5613
Domain Number 1 Region: 30-174
Classification Level Classification E-value
Superfamily Regulatory protein AraC 0.00000000000000106
Family Regulatory protein AraC 0.026
Further Details:      
 
Domain Number 2 Region: 238-288
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000000237
Family AraC type transcriptional activator 0.018
Further Details:      
 
Domain Number 3 Region: 186-236
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000153
Family Tetracyclin repressor-like, N-terminal domain 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 324057.Pjdr2_5613
Sequence length 292
Comment (Paenibacillus JDR 2)
Sequence
MNSNSSGGFETAEFLFHAISELDKQGSIWPVRGGMTETRQGYSAGPKRIESYSLHIVKEG
FVRVEWDADNGVTLSAGDLFCLFPARTYTYYAIEGEKPPRMSWIVMDGPRAAEMLALTGI
SCERPFLENAWTQEAERALLGLLDWMRSRETESAHVRSLDMQSLLYRLLAALCRTAPHAY
ALNATDWVKQSMSYIRQHATEGITVQQAAKAAGMNRTYYSVAFSEKVGMPPSEFITQVRM
ESAKRLLAETDASITEVAYTTGYSSLYAFTRTFKNRMGETPTAYREAIWKRK
Download sequence
Identical sequences C6D447
gi|251799576|ref|YP_003014307.1| 324057.Pjdr2_5613 WP_015847159.1.29859

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]