SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 324602.Caur_0857 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  324602.Caur_0857
Domain Number 1 Region: 22-133
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.24e-25
Family PAS domain of steroid receptor coactivator 1A, NCo-A1 0.056
Further Details:      
 
Domain Number 2 Region: 255-375
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.37e-23
Family Heme-binding PAS domain 0.072
Further Details:      
 
Domain Number 3 Region: 129-256
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 6.28e-19
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.05
Further Details:      
 
Domain Number 4 Region: 522-617
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000000314
Family Anti-sigma factor antagonist SpoIIaa 0.0065
Further Details:      
 
Domain Number 5 Region: 374-493
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000000242
Family Heme-binding PAS domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 324602.Caur_0857
Sequence length 653
Comment (Chloroflexus aurantiacus J 10 fl)
Sequence
MTHQSSSSPSLPPHQLEHFSRVLEFAGLILTESDAQGNITYINQATRRYFGYAPEECIGK
SVLAFTHPDDRETLQQTMIELVNRQQRSAEIENRVIHRDGTVCTFLWSIVIHYDDNGNLT
GFTSIGQDISTLHQLRDKLYEKREILYNVIDNLPLGIFWKDKESRFLGCNRRVLQDAGLS
TFAEIIGKTDFELPWRDKAAAYQAHDQVVLTSGPRLNIEETLVRGDGSSIWLRTGKVPLI
RNQQVAGVIGFYEDITEQQQKEQERRTLLLLVENAPDGIALLDPQLTITYANPAWLTMLG
KHELVGQSWVDLVHPDDRPQIATIVQQAKIGSSPRTRLRYIHSDGSVITAYISLPVLRNR
QGTITGYGLINHDITEELKSAERLRASEQRQRALLQAIPDLIFLMTPDGVFLDYHTNEIA
FAVPPEQFLNRHFAEVLPPALAELTARNLEELKRTGSIQRYEYQMQIDGQIRDYEGRMTL
SGNDVLVAIRDITDRRQSERERQTIAMQEQIIAAQQAILHELSTPLLPIADGIVAMPLIG
AIDSSRAQLVMESLLSGVAEYRAAIAIIDITGVKVVDTQVAGALLRTAQAAGMLGAQVVI
TGIRPEIAQTMVYIGADLGNVVTKATLQEGIAFALNHRRVKQSTQNGNVRMMK
Download sequence
Identical sequences A9WGZ5
WP_012256746.1.35445 YP_001634479.1.55443 gi|222524209|ref|YP_002568680.1| 324602.Caur_0857 480224.Chy400_0930 gi|163846435|ref|YP_001634479.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]