SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 324602.Caur_1307 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  324602.Caur_1307
Domain Number 1 Region: 161-257
Classification Level Classification E-value
Superfamily SpoIIaa-like 7.65e-20
Family Anti-sigma factor antagonist SpoIIaa 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 324602.Caur_1307
Sequence length 292
Comment (Chloroflexus aurantiacus J 10 fl)
Sequence
MADIFTDLQDFLLARRSAMEHALAQQVQRQSAGYARFNQEELSFSVGTTIESLAEAIGTQ
DLLPLLAYAEALGEVRAHTGFLLSDVLIAVDIFRSLIWDVLMAFAAERPDCTVDTVRAIE
DMLEQFRRAIVTSFSFTYNQLHHQFRDQTDQIEAQQQTIRELSTPILPLYEGILVVPLVG
AIDSFRAGQMMERLLTTVAERQSDIVIIDITGVPVIDTAVASYLLQTARAAQLIGAQVIL
VGIGPEIAQTIVQLGVDLGHILIGANLQNGVELAFRRLGRQIVRKRSDHHER
Download sequence
Identical sequences A9W9P9
gi|222524701|ref|YP_002569172.1| gi|163846880|ref|YP_001634924.1| WP_012257191.1.35445 YP_001634924.1.55443 324602.Caur_1307 480224.Chy400_1428

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]