SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 324602.Caur_1309 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  324602.Caur_1309
Domain Number 1 Region: 162-271
Classification Level Classification E-value
Superfamily SpoIIaa-like 4.12e-21
Family Anti-sigma factor antagonist SpoIIaa 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 324602.Caur_1309
Sequence length 281
Comment (Chloroflexus aurantiacus J 10 fl)
Sequence
MSAILSSLAAFIRERLPQTGARLLHAVQSSSSGYASIPADELRPALQRSVETICAVFGDN
NAGPLNEWAPYIGERRARMGLSLDDMMSVVSGIREFCWQELTEFGSDRLTIGDVRQFEDA
ISEFNRLLLLGYSQAMLTLQQELHDQAEQIAAQQQTIRELSTPILPLYEGILVLPLVGAI
DSFRAGQIMERLLTAIAERQSDIVIIDITGVPVIDTAVANYLLQTARAAQLIGAQVILVG
IGPEIAQTIVQLGVDLRGIQIGANLQAGIELALSQQGYTIR
Download sequence
Identical sequences A9W9Q1
WP_012257193.1.35445 YP_001634926.1.55443 324602.Caur_1309 480224.Chy400_1430 gi|222524703|ref|YP_002569174.1| gi|163846882|ref|YP_001634926.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]