SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 324602.Caur_1797 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  324602.Caur_1797
Domain Number 1 Region: 117-356
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 5.63e-53
Family D-glucarate dehydratase-like 0.00019
Further Details:      
 
Domain Number 2 Region: 5-126
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 5.46e-24
Family Enolase N-terminal domain-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 324602.Caur_1797
Sequence length 362
Comment (Chloroflexus aurantiacus J 10 fl)
Sequence
MSTVIRTLSVAPLDIPLRSPFGIAGGAQEVARNLLVTVELMNGVRGYGEAAPFPAFNGET
QEKALQAIESVRSAVEGGDVREWRAIAGLLRDRIPASGSARCAIETAILDALTRHYRLPM
YVFFGGAGHTLETDMTITTGTVEEAALATLDILERGIRQIKVKIGGYDVQHDLARITAIR
ALAPDAPLILDGNGGFTAETMLELLGALSLQQIVPALVEQPVAADDWPGLRQLVQWGGAP
IAADETASSSLNVLRIVQERAAHVINIKLMKTGIVEALEIAAIARAAGLGLMIGGMVESI
LAMTVSAHFAAGLGGFRFVDLDTPLFLATNPFQGGFELRGGVIDLCHIATGHGVEPATLL
AA
Download sequence
Identical sequences A9WD47
WP_012257668.1.35445 YP_001635403.1.55443 gi|163847359|ref|YP_001635403.1| gi|222525204|ref|YP_002569675.1| 324602.Caur_1797 480224.Chy400_1944

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]