SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 324602.Caur_2004 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  324602.Caur_2004
Domain Number 1 Region: 240-341
Classification Level Classification E-value
Superfamily SpoIIaa-like 7.06e-19
Family Anti-sigma factor antagonist SpoIIaa 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 324602.Caur_2004
Sequence length 353
Comment (Chloroflexus aurantiacus J 10 fl)
Sequence
MTNVQTPNNAHTIVQQWREQILSNLLWALVVLGGIALIVGSWADYSAAGERALPYIGIYF
LTYLSIVVISLVRRLQAKIRALLLLIVLGAIATFLLVTFGLVGSGRILWLGINVLALIYF
DRLGSIVALILSLIVMMITAAIYVTGNASFVTPETLAVQDTIEDWAGSIGLYLATNMLTL
IPFRYLLQRLEGLAQQATAEAVRARLHAQQVEVHAQELEQQTAQLQRTEHMLRNVVQSLE
TPTVEIADQVLLAPIVGQIDHQRADTLLKRLLSVVSERRVKLIVIDVAGVPAFDTMAAQS
LMQTVQALRLIGCEAVITGISPAMAQTITALGIDMKTIATARSPQDVLLRNMM
Download sequence
Identical sequences A9WEF7
gi|222525416|ref|YP_002569887.1| gi|163847564|ref|YP_001635608.1| WP_012257873.1.35445 YP_001635608.1.55443 324602.Caur_2004 480224.Chy400_2161

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]